PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v3384730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WOX
Protein Properties Length: 218aa    MW: 24528.8 Da    PI: 5.952
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v3384730.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.31e-2178138257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      r+R+t+t+ ql+ Le+ F + n +ps+++++e+A +l    +++e++V++WFqNrRa+ k+
  Lj1g3v3384730.1  78 RQRWTPTPLQLQMLEQIFDQgNGTPSKQKIKEIAIELgqhgQISETNVYNWFQNRRARSKR 138
                      89*****************99**************************************97 PP

2Wus_type_Homeobox98.17e-3277140265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtPtp Q+++Le+++++G  tP+k++i++i+ eL ++G+i+++NV++WFQNr+aR+++kq
    Lj1g3v3384730.1  77 ARQRWTPTPLQLQMLEQIFDQGNGTPSKQKIKEIAIELGQHGQISETNVYNWFQNRRARSKRKQ 140
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-1774140IPR009057Homeodomain-like
PROSITE profilePS5007115.35474139IPR001356Homeobox domain
SMARTSM003892.7E-1676143IPR001356Homeobox domain
SuperFamilySSF466891.07E-1977140IPR009057Homeodomain-like
CDDcd000864.97E-1678140No hitNo description
PfamPF000461.8E-1978138IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MEGEQHDISN GGGLYVKVMT DEQMELLRQQ ISVYATICDS LVEMHKAITT QQDLAGLRLG  60
NLYCDPLMVC SGHKITARQR WTPTPLQLQM LEQIFDQGNG TPSKQKIKEI AIELGQHGQI  120
SETNVYNWFQ NRRARSKRKQ LAPTTPSHAE LEAAETEAVE SPKEKRISAA ESVQVLQPYE  180
NSSSPHRLKD FYIQSPDIGF EQLLGKIEAG GCFSSYFL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131139RRARSKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.219760.0cell culture
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1429210.0BT142921.1 Lotus japonicus clone JCVI-FLLj-5M11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014500511.11e-125PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ5QMM35e-78WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLI3SR231e-147I3SR23_LOTJA; Uncharacterized protein
STRINGGLYMA04G01830.11e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.12e-70WUSCHEL related homeobox 13